SCOPe 2.06: Domain d3k2pb_: 3k2p B:

Lineage for d3k2pb_ (3k2p B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d3k2pb_: 3k2p B: [178981]
   automated match to d1o1wa_
   protein/RNA complex; complexed with jth, mn

Details for d3k2pb_

PDB Entry: 3k2p, 2.04 Å

PDB Description: HIV-1 Reverse Transcriptase Isolated RnaseH Domain with the Inhibitor beta-thujaplicinol Bound at the Active Site

PDB Compounds: (B:) reverse transcriptase

SCOPe Domain Sequences for d3k2pb_:

Sequence; same for both SEQRES and ATOM records:

>d3k2pb_ c.55.3.1 (B:) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
yqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylal
qdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggne
qvdklvsagir

Timeline for d3k2pb_:

• d3k2pb_ first appeared in SCOPe 2.01
  
• d3k2pb_ appears in SCOPe 2.05
  
• d3k2pb_ appears in SCOPe 2.07
  
• d3k2pb_ appears in the current release, SCOPe 2.08