Lineage for d3k2ab_ (3k2a B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691970Protein automated matches [190360] (3 species)
    not a true protein
  7. 2691983Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)
  8. 2691988Domain d3k2ab_: 3k2a B: [178979]
    automated match to d1x2na1
    complexed with act, cl

Details for d3k2ab_

PDB Entry: 3k2a (more details), 1.95 Å

PDB Description: crystal structure of the homeobox domain of human homeobox protein meis2
PDB Compounds: (B:) Homeobox protein Meis2

SCOPe Domain Sequences for d3k2ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k2ab_ a.4.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpkvatnimrawlfqhlthpypseeqkkqlaqdtgltilqvnnwfinarrrivqpm

SCOPe Domain Coordinates for d3k2ab_:

Click to download the PDB-style file with coordinates for d3k2ab_.
(The format of our PDB-style files is described here.)

Timeline for d3k2ab_: