SCOPe 2.08: Domain d3k2aa_: 3k2a A:

Lineage for d3k2aa_ (3k2a A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein automated matches [190360] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)

8. Domain d3k2aa_: 3k2a A: [178978]
   automated match to d1x2na1
   complexed with act, cl

Details for d3k2aa_

PDB Entry: 3k2a, 1.95 Å

PDB Description: crystal structure of the homeobox domain of human homeobox protein meis2

PDB Compounds: (A:) Homeobox protein Meis2

SCOPe Domain Sequences for d3k2aa_:

Sequence; same for both SEQRES and ATOM records:

>d3k2aa_ a.4.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkvatnimrawlfqhlthpypseeqkkqlaqdtgltilqvnnwfinarrrivqpm

Timeline for d3k2aa_:

• d3k2aa_ first appeared in SCOPe 2.01
  
• d3k2aa_ appears in SCOPe 2.07