Lineage for d3k22a_ (3k22 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009489Domain d3k22a_: 3k22 A: [178972]
    automated match to d1m2za_
    complexed with jzr, jzs

Details for d3k22a_

PDB Entry: 3k22 (more details), 2.1 Å

PDB Description: glucocorticoid receptor with bound alaninamide 10 with tif2 peptide
PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d3k22a_:

Sequence, based on SEQRES records: (download)

>d3k22a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfr
nlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpgmydqckh
mlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkre
gnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkys
ngnikkllfhq

Sequence, based on observed residues (ATOM records): (download)

>d3k22a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfr
nlhlddqmtllqyswmylmafalgwrsyrqsanllcfapdliineqrmtlpgmydqckhm
lyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkreg
nssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysn
gnikkllfhq

SCOPe Domain Coordinates for d3k22a_:

Click to download the PDB-style file with coordinates for d3k22a_.
(The format of our PDB-style files is described here.)

Timeline for d3k22a_: