Lineage for d3k1sh_ (3k1s H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696555Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) (S)
  5. 2696565Family a.7.2.0: automated matches [191602] (1 protein)
    not a true family
  6. 2696566Protein automated matches [191097] (4 species)
    not a true protein
  7. 2696567Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189079] (1 PDB entry)
  8. 2696575Domain d3k1sh_: 3k1s H: [178962]
    Other proteins in same PDB: d3k1sa2, d3k1sd2
    automated match to d1e2aa_
    complexed with cl, mg, na

Details for d3k1sh_

PDB Entry: 3k1s (more details), 2.3 Å

PDB Description: crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis
PDB Compounds: (H:) PTS system, cellobiose-specific IIA component

SCOPe Domain Sequences for d3k1sh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k1sh_ a.7.2.0 (H:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mttaeqipfqlilnsgnarsfamealqfakqgkmaeadeamvkakeaineahhfqteliq
seargekteisvllihaqdhlmnaitvkelaaefidlykkleakg

SCOPe Domain Coordinates for d3k1sh_:

Click to download the PDB-style file with coordinates for d3k1sh_.
(The format of our PDB-style files is described here.)

Timeline for d3k1sh_: