![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.155: H-NS histone-like proteins [81274] (1 superfamily) multihelical oligomeric protein; structure of whole subunit is not known yet but are probably composed of three different domains |
![]() | Superfamily a.155.1: H-NS histone-like proteins [81273] (1 family) ![]() available NMR structures suggest two very different dimerisation modes of the N-terminal domain |
![]() | Family a.155.1.1: H-NS histone-like proteins [81272] (2 proteins) |
![]() | Protein H1 protein (H-NS) [47733] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47734] (4 PDB entries) |
![]() | Domain d1hnr__: 1hnr - [17896] C-terminal DNA-binding domain; res. 90-136 |
PDB Entry: 1hnr (more details)
SCOP Domain Sequences for d1hnr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnr__ a.155.1.1 (-) H1 protein (H-NS) {Escherichia coli} aqrpakysyvdengetktwtgqgrtpavikkamdeqgkslddflikq
Timeline for d1hnr__: