Lineage for d1hnr__ (1hnr -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545358Fold a.155: H-NS histone-like proteins [81274] (1 superfamily)
    multihelical oligomeric protein; structure of whole subunit is not known yet but are probably composed of three different domains
  4. 545359Superfamily a.155.1: H-NS histone-like proteins [81273] (1 family) (S)
    available NMR structures suggest two very different dimerisation modes of the N-terminal domain
  5. 545360Family a.155.1.1: H-NS histone-like proteins [81272] (2 proteins)
  6. 545365Protein H1 protein (H-NS) [47733] (1 species)
  7. 545366Species Escherichia coli [TaxId:562] [47734] (4 PDB entries)
  8. 545371Domain d1hnr__: 1hnr - [17896]
    C-terminal DNA-binding domain; res. 90-136

Details for d1hnr__

PDB Entry: 1hnr (more details)

PDB Description: h-ns (dna-binding domain)

SCOP Domain Sequences for d1hnr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnr__ a.155.1.1 (-) H1 protein (H-NS) {Escherichia coli}
aqrpakysyvdengetktwtgqgrtpavikkamdeqgkslddflikq

SCOP Domain Coordinates for d1hnr__:

Click to download the PDB-style file with coordinates for d1hnr__.
(The format of our PDB-style files is described here.)

Timeline for d1hnr__: