SCOPe 2.08: Domain d3k1sa1: 3k1s A:1-106

Lineage for d3k1sa1 (3k1s A:1-106)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families)

5. Family a.7.2.0: automated matches [191602] (1 protein)
   not a true family

6. Protein automated matches [191097] (4 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189079] (1 PDB entry)

8. Domain d3k1sa1: 3k1s A:1-106 [178955]
   Other proteins in same PDB: d3k1sa2, d3k1sd2
   automated match to d1e2aa_
   complexed with cl, mg, na

Details for d3k1sa1

PDB Entry: 3k1s, 2.3 Å

PDB Description: crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis

PDB Compounds: (A:) PTS system, cellobiose-specific IIA component

SCOPe Domain Sequences for d3k1sa1:

Sequence; same for both SEQRES and ATOM records:

>d3k1sa1 a.7.2.0 (A:1-106) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mmttaeqipfqlilnsgnarsfamealqfakqgkmaeadeamvkakeaineahhfqteli
qseargekteisvllihaqdhlmnaitvkelaaefidlykkleakg

Timeline for d3k1sa1:

• d3k1sa1 first appeared in SCOPe 2.01, called d3k1sa_
  
• d3k1sa1 appears in SCOPe 2.07