SCOPe 2.06: Domain d3k1kc_: 3k1k C:

Lineage for d3k1kc_ (3k1k C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)

8. Domain d3k1kc_: 3k1k C: [178953]
   Other proteins in same PDB: d3k1ka_, d3k1kb_, d3k1kd2
   automated match to d1vhpa_

Details for d3k1kc_

PDB Entry: 3k1k, 2.15 Å

PDB Description: green fluorescent protein bound to enhancer nanobody

PDB Compounds: (C:) Enhancer

SCOPe Domain Sequences for d3k1kc_:

Sequence; same for both SEQRES and ATOM records:

>d3k1kc_ b.1.1.1 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggalvqpggslrlscaasgfpvnrysmrwyrqapgkerewvagmssagdrssy
edsvkgrftisrddarntvylqmnslkpedtavyycnvnvgfeywgqgtqvtvs

Timeline for d3k1kc_:

• d3k1kc_ first appeared in SCOPe 2.01
  
• d3k1kc_ appears in SCOPe 2.05
  
• d3k1kc_ is called d3k1kc1 in SCOPe 2.07
  
• d3k1kc_ appears in the current release, SCOPe 2.08, called d3k1kc1