Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (11 species) not a true protein |
Species Lama pacos [TaxId:30538] [189142] (2 PDB entries) |
Domain d3k1kc_: 3k1k C: [178953] Other proteins in same PDB: d3k1ka_, d3k1kb_ automated match to d1vhpa_ |
PDB Entry: 3k1k (more details), 2.15 Å
SCOPe Domain Sequences for d3k1kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k1kc_ b.1.1.1 (C:) automated matches {Lama pacos [TaxId: 30538]} qvqlvesggalvqpggslrlscaasgfpvnrysmrwyrqapgkerewvagmssagdrssy edsvkgrftisrddarntvylqmnslkpedtavyycnvnvgfeywgqgtqvtvs
Timeline for d3k1kc_: