SCOPe 2.08: Domain d3k1kc1: 3k1k C:1-111

Lineage for d3k1kc1 (3k1k C:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d3k1kc1: 3k1k C:1-111 [178953]
   Other proteins in same PDB: d3k1ka_, d3k1kb_, d3k1kc2, d3k1kd2
   automated match to d1vhpa_

Details for d3k1kc1

PDB Entry: 3k1k, 2.15 Å

PDB Description: green fluorescent protein bound to enhancer nanobody

PDB Compounds: (C:) Enhancer

SCOPe Domain Sequences for d3k1kc1:

Sequence; same for both SEQRES and ATOM records:

>d3k1kc1 b.1.1.1 (C:1-111) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggalvqpggslrlscaasgfpvnrysmrwyrqapgkerewvagmssagdrssy
edsvkgrftisrddarntvylqmnslkpedtavyycnvnvgfeywgqgtqvtv

Timeline for d3k1kc1:

• d3k1kc1 first appeared in SCOPe 2.01, called d3k1kc_
  
• d3k1kc1 appears in SCOPe 2.07