Lineage for d3k1kc1 (3k1k C:1-111)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347169Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)
  8. 2347209Domain d3k1kc1: 3k1k C:1-111 [178953]
    Other proteins in same PDB: d3k1ka_, d3k1kb_, d3k1kc2, d3k1kd2
    automated match to d1vhpa_

Details for d3k1kc1

PDB Entry: 3k1k (more details), 2.15 Å

PDB Description: green fluorescent protein bound to enhancer nanobody
PDB Compounds: (C:) Enhancer

SCOPe Domain Sequences for d3k1kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k1kc1 b.1.1.1 (C:1-111) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggalvqpggslrlscaasgfpvnrysmrwyrqapgkerewvagmssagdrssy
edsvkgrftisrddarntvylqmnslkpedtavyycnvnvgfeywgqgtqvtv

SCOPe Domain Coordinates for d3k1kc1:

Click to download the PDB-style file with coordinates for d3k1kc1.
(The format of our PDB-style files is described here.)

Timeline for d3k1kc1: