SCOPe 2.06: Domain d3k1kb_: 3k1k B:

Lineage for d3k1kb_ (3k1k B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (177 PDB entries)
   Uniprot P42212

8. Domain d3k1kb_: 3k1k B: [178952]
   Other proteins in same PDB: d3k1kc_, d3k1kd1, d3k1kd2
   automated match to d1qyoa_

Details for d3k1kb_

PDB Entry: 3k1k, 2.15 Å

PDB Description: green fluorescent protein bound to enhancer nanobody

PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d3k1kb_:

Sequence; same for both SEQRES and ATOM records:

>d3k1kb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tfsygvqcfsrypdhmkrhdffksampegyvqertisfkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

Timeline for d3k1kb_:

• d3k1kb_ first appeared in SCOPe 2.01
  
• d3k1kb_ appears in SCOPe 2.05
  
• d3k1kb_ appears in SCOPe 2.07
  
• d3k1kb_ appears in the current release, SCOPe 2.08