SCOPe 2.08: Domain d3k1ia_: 3k1i A:

Lineage for d3k1ia_ (3k1i A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families)
   can form closed, open and helix-swapped bundles

5. Family a.24.19.0: automated matches [191633] (1 protein)
   not a true family

6. Protein automated matches [191166] (3 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [189381] (2 PDB entries)

8. Domain d3k1ia_: 3k1i A: [178949]
   automated match to d1vh6b_

Details for d3k1ia_

PDB Entry: 3k1i, 2.7 Å

PDB Description: Crystal strcture of FliS-HP1076 complex in H. pylori

PDB Compounds: (A:) Flagellar protein

SCOPe Domain Sequences for d3k1ia_:

Sequence; same for both SEQRES and ATOM records:

>d3k1ia_ a.24.19.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
spakliemlyegilrfssqakrcienediekkiyyinrvtdiftellnildyekggevav
yltglythqikvltqanvendaskidlvlnvarglleawreihsde

Timeline for d3k1ia_:

• d3k1ia_ first appeared in SCOPe 2.01
  
• d3k1ia_ appears in SCOPe 2.07