![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
![]() | Family a.39.2.0: automated matches [191595] (1 protein) not a true family |
![]() | Protein automated matches [191085] (10 species) not a true protein |
![]() | Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [189159] (1 PDB entry) |
![]() | Domain d3k1ea_: 3k1e A: [178947] automated match to d1r5ra_ complexed with cl, mg, peu |
PDB Entry: 3k1e (more details), 1.85 Å
SCOPe Domain Sequences for d3k1ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k1ea_ a.39.2.0 (A:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]} vtprrdaeypppefleamkplreicikktgvteeaiiefsdgkvhedenlkcymnclfhe akvvddtghvhleklhdalpdsmhdialhmgkrclypegenlcekafwlhkcwkesdpkh yfli
Timeline for d3k1ea_: