SCOPe 2.02: Domain d3k1ea_: 3k1e A:

Lineage for d3k1ea_ (3k1e A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.0: automated matches [191595] (1 protein)
   not a true family

6. Protein automated matches [191085] (5 species)
   not a true protein

7. Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [189159] (1 PDB entry)

8. Domain d3k1ea_: 3k1e A: [178947]
   automated match to d1r5ra_
   complexed with cl, mg, peu

Details for d3k1ea_

PDB Entry: 3k1e, 1.85 Å

PDB Description: Crystal structure of odorant binding protein 1 (AaegOBP1) from Aedes aegypti

PDB Compounds: (A:) odorant binding protein

SCOPe Domain Sequences for d3k1ea_:

Sequence; same for both SEQRES and ATOM records:

>d3k1ea_ a.39.2.0 (A:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
vtprrdaeypppefleamkplreicikktgvteeaiiefsdgkvhedenlkcymnclfhe
akvvddtghvhleklhdalpdsmhdialhmgkrclypegenlcekafwlhkcwkesdpkh
yfli

Timeline for d3k1ea_:

• d3k1ea_ first appeared in SCOPe 2.01
  
• d3k1ea_ appears in SCOPe 2.03
  
• d3k1ea_ appears in the current release, SCOPe 2.08