SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3k1aa_ (3k1a A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143391Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 protein domains)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2143502Protein automated matches [190199] (3 species)
    not a true protein
  7. 2143503Species Azotobacter vinelandii [TaxId:354] [186943] (13 PDB entries)
  8. 2143540Domain d3k1aa_: 3k1a A: [178943]
    Other proteins in same PDB: d3k1ab_, d3k1ad_
    automated match to d1h1la_
    complexed with ca, cfn, clf, hca

Details for d3k1aa_

PDB Entry: 3k1a (more details), 2.23 Å

PDB Description: Insights into substrate binding at FeMo-cofactor in nitrogenase from the structure of an alpha-70Ile MoFe protein variant
PDB Compounds: (A:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d3k1aa_:

Sequence, based on SEQRES records: (download)

>d3k1aa_ c.92.2.3 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
agskgivwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

Sequence, based on observed residues (ATOM records): (download)

>d3k1aa_ c.92.2.3 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
sreevesliqevlevypekarkdrnkhlavnciisnkksqpglmtirgcayagskgivwg
pikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdivfggdkklak
lidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrcegfrgvsqsl
ghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrilleemglrcvaqw
sgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptktieslraia
akfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvigayedlgme
vvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsgikekfifqk
mgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOPe Domain Coordinates for d3k1aa_:

Click to download the PDB-style file with coordinates for d3k1aa_.
(The format of our PDB-style files is described here.)

Timeline for d3k1aa_: