Lineage for d3k0pa_ (3k0p A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397367Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2397368Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2397383Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (115 PDB entries)
    Uniprot P05092
  8. 2397453Domain d3k0pa_: 3k0p A: [178940]
    automated match to d1ak4a_
    mutant

Details for d3k0pa_

PDB Entry: 3k0p (more details), 1.65 Å

PDB Description: cryogenic structure of cypa mutant ser99thr
PDB Compounds: (A:) cyclophilin a

SCOPe Domain Sequences for d3k0pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgiltmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgq

SCOPe Domain Coordinates for d3k0pa_:

Click to download the PDB-style file with coordinates for d3k0pa_.
(The format of our PDB-style files is described here.)

Timeline for d3k0pa_: