Lineage for d1ihfb_ (1ihf B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328278Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2328279Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2328280Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2328313Protein Integration host factor beta subunit (IHFB) [88880] (1 species)
    heterodimer of two related subunits
  7. 2328314Species Escherichia coli [TaxId:562] [88881] (5 PDB entries)
  8. 2328318Domain d1ihfb_: 1ihf B: [17894]
    Other proteins in same PDB: d1ihfa_
    protein/DNA complex; complexed with cd

Details for d1ihfb_

PDB Entry: 1ihf (more details), 2.5 Å

PDB Description: integration host factor/dna complex
PDB Compounds: (B:) protein (integration host factor (beta) (ihf))

SCOPe Domain Sequences for d1ihfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihfb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]}
mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniyg

SCOPe Domain Coordinates for d1ihfb_:

Click to download the PDB-style file with coordinates for d1ihfb_.
(The format of our PDB-style files is described here.)

Timeline for d1ihfb_: