SCOPe 2.01: Domain d3jzqb_: 3jzq B:

Lineage for d3jzqb_ (3jzq B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.0: automated matches [191556] (1 protein)
   not a true family

6. Protein automated matches [190960] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188578] (9 PDB entries)

8. Domain d3jzqb_: 3jzq B: [178934]
   automated match to d1ycqa_
   complexed with so4

Details for d3jzqb_

PDB Entry: 3jzq, 1.8 Å

PDB Description: Human MDMX liganded with a 12mer peptide inhibitor (pDIQ)

PDB Compounds: (B:) Protein Mdm4

SCOPe Domain Sequences for d3jzqb_:

Sequence; same for both SEQRES and ATOM records:

>d3jzqb_ a.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
lgrqsfsvkdpsplydmlrknlvtlat

Timeline for d3jzqb_:

• d3jzqb_ is new in SCOPe 2.01-stable
  
• d3jzqb_ appears in SCOPe 2.02
  
• d3jzqb_ appears in the current release, SCOPe 2.08