Lineage for d3jzpa_ (3jzp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712548Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 2712549Protein automated matches [190960] (1 species)
    not a true protein
  7. 2712550Species Human (Homo sapiens) [TaxId:9606] [188578] (22 PDB entries)
  8. 2712554Domain d3jzpa_: 3jzp A: [178932]
    automated match to d1ycqa_
    complexed with k

Details for d3jzpa_

PDB Entry: 3jzp (more details), 1.74 Å

PDB Description: Human MDMX liganded with a 12mer peptide inhibitor (pDI6W)
PDB Compounds: (A:) Protein Mdm4

SCOPe Domain Sequences for d3jzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jzpa_ a.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
ellgrqsfsvkdpsplydmlrknlvtl

SCOPe Domain Coordinates for d3jzpa_:

Click to download the PDB-style file with coordinates for d3jzpa_.
(The format of our PDB-style files is described here.)

Timeline for d3jzpa_: