SCOPe 2.07: Domain d3jy1a1: 3jy1 A:1-225

Lineage for d3jy1a1 (3jy1 A:1-225)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (14 species)
   not a true protein

7. Species Bacillus cereus [TaxId:222523] [189468] (4 PDB entries)

8. Domain d3jy1a1: 3jy1 A:1-225 [178920]
   Other proteins in same PDB: d3jy1a2
   automated match to d2b6ca1
   protein/DNA complex

Details for d3jy1a1

PDB Entry: 3jy1, 1.75 Å

PDB Description: Bacillus cereus Alkylpurine DNA Glycosylase AlkD Bound to DNA Containing an Abasic Site (across from C)

PDB Compounds: (A:) Alkylpurine DNA Glycosylase AlkD

SCOPe Domain Sequences for d3jy1a1:

Sequence; same for both SEQRES and ATOM records:

>d3jy1a1 a.118.1.0 (A:1-225) automated matches {Bacillus cereus [TaxId: 222523]}
mhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdqkd
fqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivptfl
gdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsskeff
iqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqny

Timeline for d3jy1a1:

• d3jy1a1 first appeared in SCOPe 2.01, called d3jy1a_
  
• d3jy1a1 appears in SCOPe 2.06