Class a: All alpha proteins [46456] (290 folds) |
Fold a.54: Domain of early E2A DNA-binding protein, ADDBP [47723] (1 superfamily) 4 helices; bundle, partly opened |
Superfamily a.54.1: Domain of early E2A DNA-binding protein, ADDBP [47724] (2 families) this domain is the first in the fragment of known structure automatically mapped to Pfam PF02236 |
Family a.54.1.1: Domain of early E2A DNA-binding protein, ADDBP [47725] (1 protein) |
Protein Domain of early E2A DNA-binding protein, ADDBP [47726] (1 species) Single-stranded DNA-binding protein |
Species Human adenovirus type 5 [TaxId:28285] [47727] (4 PDB entries) |
Domain d1advb1: 1adv B:180-265 [17892] Other proteins in same PDB: d1adva2, d1adva3, d1advb2, d1advb3 complexed with zn |
PDB Entry: 1adv (more details), 3.2 Å
SCOPe Domain Sequences for d1advb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1advb1 a.54.1.1 (B:180-265) Domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]} awekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnkt fvtmmgrflqaylqsfaevtykhhep
Timeline for d1advb1: