![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (24 families) ![]() |
![]() | Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
![]() | Protein automated matches [190220] (4 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:222523] [189468] (4 PDB entries) |
![]() | Domain d3jxza_: 3jxz A: [178919] automated match to d2b6ca1 protein/DNA complex |
PDB Entry: 3jxz (more details), 1.75 Å
SCOPe Domain Sequences for d3jxza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jxza_ a.118.1.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]} mhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdqkd fqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivptfl gdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsskeff iqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqny
Timeline for d3jxza_: