SCOPe 2.08: Domain d3jxwa_: 3jxw A:

Lineage for d3jxwa_ (3jxw A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (118 PDB entries)
   Uniprot P11309 33-305 ! Uniprot P11309 32-308

8. Domain d3jxwa_: 3jxw A: [178917]
   automated match to d1xqza_
   complexed with lxg

Details for d3jxwa_

PDB Entry: 3jxw, 2.8 Å

PDB Description: Discovery of 3H-benzo[4,5]thieno[3,2-d]pyrimidin-4-ones as Potent, Highly Selective and Orally Bioavailable Pim Kinases Inhibitors

PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOPe Domain Sequences for d3jxwa_:

Sequence; same for both SEQRES and ATOM records:

>d3jxwa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs

Timeline for d3jxwa_:

• d3jxwa_ first appeared in SCOPe 2.01
  
• d3jxwa_ appears in SCOPe 2.07