SCOPe 2.01: Domain d3jxsa_: 3jxs A:

Lineage for d3jxsa_ (3jxs A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.14: CBM4/9 [74893] (4 proteins)

6. Protein automated matches [191099] (1 species)
   not a true protein

7. Species Rhodothermus marinus [TaxId:29549] [189091] (1 PDB entry)

8. Domain d3jxsa_: 3jxs A: [178914]
   automated match to d1k42a_
   complexed with act, ca

Details for d3jxsa_

PDB Entry: 3jxs, 1.6 Å

PDB Description: crystal structure of xg34, an evolved xyloglucan binding cbm

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d3jxsa_:

Sequence; same for both SEQRES and ATOM records:

>d3jxsa_ b.18.1.14 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpydihatalpvnvrpgvtytytiwaraeqdgavvsftvgnqshddygrlheqq
ittewqpftfeftvsdqetvirapihfgfaanvgntiyidglaivd

Timeline for d3jxsa_:

• d3jxsa_ is new in SCOPe 2.01-stable
  
• d3jxsa_ appears in SCOPe 2.02
  
• d3jxsa_ appears in the current release, SCOPe 2.08