Lineage for d3jxsa_ (3jxs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774616Family b.18.1.14: CBM4/9 [74893] (4 proteins)
  6. 2774630Protein automated matches [191099] (1 species)
    not a true protein
  7. 2774631Species Rhodothermus marinus [TaxId:29549] [189091] (9 PDB entries)
  8. 2774639Domain d3jxsa_: 3jxs A: [178914]
    automated match to d1k42a_
    complexed with act, ca

Details for d3jxsa_

PDB Entry: 3jxs (more details), 1.6 Å

PDB Description: crystal structure of xg34, an evolved xyloglucan binding cbm
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d3jxsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jxsa_ b.18.1.14 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpydihatalpvnvrpgvtytytiwaraeqdgavvsftvgnqshddygrlheqq
ittewqpftfeftvsdqetvirapihfgfaanvgntiyidglaivd

SCOPe Domain Coordinates for d3jxsa_:

Click to download the PDB-style file with coordinates for d3jxsa_.
(The format of our PDB-style files is described here.)

Timeline for d3jxsa_: