Lineage for d3jxpa_ (3jxp A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1937961Family d.157.1.6: Coenzyme PQQ synthesis protein B, PqqB [118146] (2 proteins)
  6. 1937965Protein automated matches [191188] (1 species)
    not a true protein
  7. 1937966Species Pseudomonas putida [TaxId:160488] [189469] (1 PDB entry)
  8. 1937967Domain d3jxpa_: 3jxp A: [178913]
    automated match to d1xtoa_
    complexed with cl, zn

Details for d3jxpa_

PDB Entry: 3jxp (more details), 2.2 Å

PDB Description: crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida
PDB Compounds: (A:) Coenzyme PQQ synthesis protein B

SCOPe Domain Sequences for d3jxpa_:

Sequence, based on SEQRES records: (download)

>d3jxpa_ d.157.1.6 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
mmyiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspd
iraqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdlt
tgfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgd
nlglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtg
remghlaqngpggtlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgm
siell

Sequence, based on observed residues (ATOM records): (download)

>d3jxpa_ d.157.1.6 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
mmyiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspd
iraqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdlt
tgfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgd
nlglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtg
rmghlaqngpggtlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms
iell

SCOPe Domain Coordinates for d3jxpa_:

Click to download the PDB-style file with coordinates for d3jxpa_.
(The format of our PDB-style files is described here.)

Timeline for d3jxpa_: