Lineage for d3jxpa1 (3jxp A:1-303)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997149Family d.157.1.6: Coenzyme PQQ synthesis protein B, PqqB [118146] (2 proteins)
  6. 2997153Protein automated matches [191188] (1 species)
    not a true protein
  7. 2997154Species Pseudomonas putida [TaxId:160488] [189469] (1 PDB entry)
  8. 2997155Domain d3jxpa1: 3jxp A:1-303 [178913]
    Other proteins in same PDB: d3jxpa2, d3jxpa3
    automated match to d1xtoa_
    complexed with cl, zn

Details for d3jxpa1

PDB Entry: 3jxp (more details), 2.2 Å

PDB Description: crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida
PDB Compounds: (A:) Coenzyme PQQ synthesis protein B

SCOPe Domain Sequences for d3jxpa1:

Sequence, based on SEQRES records: (download)

>d3jxpa1 d.157.1.6 (A:1-303) automated matches {Pseudomonas putida [TaxId: 160488]}
myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdi
raqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdltt
gfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgdn
lglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtgr
emghlaqngpggtlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms
iel

Sequence, based on observed residues (ATOM records): (download)

>d3jxpa1 d.157.1.6 (A:1-303) automated matches {Pseudomonas putida [TaxId: 160488]}
myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdi
raqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdltt
gfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgdn
lglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtgr
mghlaqngpggtlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgmsi
el

SCOPe Domain Coordinates for d3jxpa1:

Click to download the PDB-style file with coordinates for d3jxpa1.
(The format of our PDB-style files is described here.)

Timeline for d3jxpa1: