Lineage for d3jxgd_ (3jxg D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2068693Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2068694Protein automated matches [191011] (13 species)
    not a true protein
  7. 2068769Species Mouse (Mus musculus) [TaxId:10090] [189158] (3 PDB entries)
  8. 2068773Domain d3jxgd_: 3jxg D: [178911]
    automated match to d1rj5a_

Details for d3jxgd_

PDB Entry: 3jxg (more details), 1.7 Å

PDB Description: ca-like domain of mouse ptprg
PDB Compounds: (D:) Receptor-type tyrosine-protein phosphatase gamma

SCOPe Domain Sequences for d3jxgd_:

Sequence, based on SEQRES records: (download)

>d3jxgd_ b.74.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pywaysgaygpehwvtssvscggshqspidildhharvgdeyqelqldgfdnessnktwm
kntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsvngrrfpvemqif
fynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpfi
lrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdhvk
sveylrnnfrpqqalndrvvsks

Sequence, based on observed residues (ATOM records): (download)

>d3jxgd_ b.74.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pywaysgaygpehwvtssvscggshqspidildhharvgdeyqelqldgfdnessnktwm
kntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsvngrrfpvemqif
fynpdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpfilrd
llpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqhvksvey
lrnnfrpqqalndrvvsks

SCOPe Domain Coordinates for d3jxgd_:

Click to download the PDB-style file with coordinates for d3jxgd_.
(The format of our PDB-style files is described here.)

Timeline for d3jxgd_: