Class b: All beta proteins [48724] (174 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189158] (2 PDB entries) |
Domain d3jxgc_: 3jxg C: [178910] automated match to d1rj5a_ |
PDB Entry: 3jxg (more details), 1.7 Å
SCOPe Domain Sequences for d3jxgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jxgc_ b.74.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dpywaysgaygpehwvtssvscggshqspidildhharvgdeyqelqldgfdnessnktw mkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsvngrrfpvemqi ffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpf ilrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdhv ksveylrnnfrpqqalndrvvsks
Timeline for d3jxgc_: