Lineage for d3jxgc_ (3jxg C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136597Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1136598Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1137116Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1137117Protein automated matches [191011] (2 species)
    not a true protein
  7. 1137130Species Mouse (Mus musculus) [TaxId:10090] [189158] (2 PDB entries)
  8. 1137133Domain d3jxgc_: 3jxg C: [178910]
    automated match to d1rj5a_

Details for d3jxgc_

PDB Entry: 3jxg (more details), 1.7 Å

PDB Description: ca-like domain of mouse ptprg
PDB Compounds: (C:) Receptor-type tyrosine-protein phosphatase gamma

SCOPe Domain Sequences for d3jxgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jxgc_ b.74.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dpywaysgaygpehwvtssvscggshqspidildhharvgdeyqelqldgfdnessnktw
mkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsvngrrfpvemqi
ffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpf
ilrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdhv
ksveylrnnfrpqqalndrvvsks

SCOPe Domain Coordinates for d3jxgc_:

Click to download the PDB-style file with coordinates for d3jxgc_.
(The format of our PDB-style files is described here.)

Timeline for d3jxgc_: