SCOPe 2.05: Domain d3jxfb_: 3jxf B:

Lineage for d3jxfb_ (3jxf B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188766] (10 PDB entries)

8. Domain d3jxfb_: 3jxf B: [178907]
   automated match to d1jcza_

Details for d3jxfb_

PDB Entry: 3jxf, 2 Å

PDB Description: ca-like domain of human ptprz

PDB Compounds: (B:) Receptor-type tyrosine-protein phosphatase zeta

SCOPe Domain Sequences for d3jxfb_:

Sequence; same for both SEQRES and ATOM records:

>d3jxfb_ b.74.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgseeigwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktsl
entfihntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfp
lemqiycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqa
aldpfillnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmq
qsgyvmlmdylqnnfreqqykfsrqvfssyt

Timeline for d3jxfb_:

• d3jxfb_ first appeared in SCOPe 2.01
  
• d3jxfb_ appears in SCOPe 2.04
  
• d3jxfb_ is called d3jxfb1 in SCOPe 2.06
  
• d3jxfb_ appears in the current release, SCOPe 2.08, called d3jxfb1