Lineage for d3jxfb1 (3jxf B:34-301)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2402282Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2402283Protein automated matches [191011] (14 species)
    not a true protein
  7. 2402364Species Human (Homo sapiens) [TaxId:9606] [188766] (17 PDB entries)
  8. 2402385Domain d3jxfb1: 3jxf B:34-301 [178907]
    Other proteins in same PDB: d3jxfb2
    automated match to d1jcza_

Details for d3jxfb1

PDB Entry: 3jxf (more details), 2 Å

PDB Description: ca-like domain of human ptprz
PDB Compounds: (B:) Receptor-type tyrosine-protein phosphatase zeta

SCOPe Domain Sequences for d3jxfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jxfb1 b.74.1.0 (B:34-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeigwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktslent
fihntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfplem
qiycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqaald
pfillnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmqqsg
yvmlmdylqnnfreqqykfsrqvfssyt

SCOPe Domain Coordinates for d3jxfb1:

Click to download the PDB-style file with coordinates for d3jxfb1.
(The format of our PDB-style files is described here.)

Timeline for d3jxfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jxfb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3jxfa_