SCOPe 2.08: Domain d3jxdr_: 3jxd R:

Lineage for d3jxdr_ (3jxd R:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein P22 C2 repressor, DNA-binding domain [47426] (1 species)

7. Species Salmonella bacteriophage P22 [TaxId:10754] [47427] (5 PDB entries)
   contains a short additional helix at C-terminus

8. Domain d3jxdr_: 3jxd R: [178905]
   automated match to d1adra_
   protein/DNA complex; complexed with rb

Details for d3jxdr_

PDB Entry: 3jxd, 2.1 Å

PDB Description: crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9c in the presence of rb+

PDB Compounds: (R:) Repressor protein C2

SCOPe Domain Sequences for d3jxdr_:

Sequence; same for both SEQRES and ATOM records:

>d3jxdr_ a.35.1.2 (R:) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]}
tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
yllkgd

Timeline for d3jxdr_:

• d3jxdr_ first appeared in SCOPe 2.01
  
• d3jxdr_ appears in SCOPe 2.07