Lineage for d3jxdl_ (3jxd L:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913577Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 913578Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 913599Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 913661Protein P22 C2 repressor, DNA-binding domain [47426] (1 species)
  7. 913662Species Salmonella bacteriophage P22 [TaxId:10754] [47427] (5 PDB entries)
    contains a short additional helix at C-terminus
  8. 913669Domain d3jxdl_: 3jxd L: [178904]
    automated match to d1adra_
    protein/DNA complex; complexed with rb

Details for d3jxdl_

PDB Entry: 3jxd (more details), 2.1 Å

PDB Description: crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9c in the presence of rb+
PDB Compounds: (L:) Repressor protein C2

SCOPe Domain Sequences for d3jxdl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jxdl_ a.35.1.2 (L:) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]}
tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
yllkgd

SCOPe Domain Coordinates for d3jxdl_:

Click to download the PDB-style file with coordinates for d3jxdl_.
(The format of our PDB-style files is described here.)

Timeline for d3jxdl_: