Lineage for d3jxbd_ (3jxb D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322523Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 2322588Protein P22 C2 repressor, DNA-binding domain [47426] (1 species)
  7. 2322589Species Salmonella bacteriophage P22 [TaxId:10754] [47427] (5 PDB entries)
    contains a short additional helix at C-terminus
  8. 2322591Domain d3jxbd_: 3jxb D: [178901]
    automated match to d1adra_
    protein/DNA complex

Details for d3jxbd_

PDB Entry: 3jxb (more details), 1.67 Å

PDB Description: Crystal structure of the P22 c2 repressor protein in complex with synthetic operator 9C
PDB Compounds: (D:) Repressor protein C2

SCOPe Domain Sequences for d3jxbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jxbd_ a.35.1.2 (D:) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]}
qlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspdy
llkgd

SCOPe Domain Coordinates for d3jxbd_:

Click to download the PDB-style file with coordinates for d3jxbd_.
(The format of our PDB-style files is described here.)

Timeline for d3jxbd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3jxbc_