![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.54: Domain of early E2A DNA-binding protein, ADDBP [47723] (1 superfamily) 4 helices; bundle, partly opened |
![]() | Superfamily a.54.1: Domain of early E2A DNA-binding protein, ADDBP [47724] (2 families) ![]() this domain is the first in the fragment of known structure automatically mapped to Pfam PF02236 |
![]() | Family a.54.1.1: Domain of early E2A DNA-binding protein, ADDBP [47725] (1 protein) |
![]() | Protein Domain of early E2A DNA-binding protein, ADDBP [47726] (1 species) Single-stranded DNA-binding protein |
![]() | Species Human adenovirus type 5 [TaxId:28285] [47727] (4 PDB entries) |
![]() | Domain d1anva1: 1anv A:179-265 [17890] Other proteins in same PDB: d1anva2, d1anva3 complexed with ium, zn |
PDB Entry: 1anv (more details), 2.7 Å
SCOPe Domain Sequences for d1anva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1anva1 a.54.1.1 (A:179-265) Domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]} sawekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnk tfvtmmgrflqaylqsfaevtykhhep
Timeline for d1anva1: