Lineage for d1anva1 (1anv A:179-265)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715126Fold a.54: Domain of early E2A DNA-binding protein, ADDBP [47723] (1 superfamily)
    4 helices; bundle, partly opened
  4. 2715127Superfamily a.54.1: Domain of early E2A DNA-binding protein, ADDBP [47724] (2 families) (S)
    this domain is the first in the fragment of known structure
    automatically mapped to Pfam PF02236
  5. 2715128Family a.54.1.1: Domain of early E2A DNA-binding protein, ADDBP [47725] (1 protein)
  6. 2715129Protein Domain of early E2A DNA-binding protein, ADDBP [47726] (1 species)
    Single-stranded DNA-binding protein
  7. 2715130Species Human adenovirus type 5 [TaxId:28285] [47727] (4 PDB entries)
  8. 2715136Domain d1anva1: 1anv A:179-265 [17890]
    Other proteins in same PDB: d1anva2, d1anva3
    complexed with ium, zn

Details for d1anva1

PDB Entry: 1anv (more details), 2.7 Å

PDB Description: adenovirus 5 dbp/uranyl fluoride soak
PDB Compounds: (A:) adenovirus single-stranded DNA-binding protein

SCOPe Domain Sequences for d1anva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1anva1 a.54.1.1 (A:179-265) Domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
sawekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnk
tfvtmmgrflqaylqsfaevtykhhep

SCOPe Domain Coordinates for d1anva1:

Click to download the PDB-style file with coordinates for d1anva1.
(The format of our PDB-style files is described here.)

Timeline for d1anva1: