Lineage for d3jx7a_ (3jx7 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745667Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 1745668Protein automated matches [190220] (12 species)
    not a true protein
  7. 1745674Species Bacillus cereus [TaxId:222523] [189468] (4 PDB entries)
  8. 1745676Domain d3jx7a_: 3jx7 A: [178899]
    automated match to d2b6ca1
    protein/DNA complex

Details for d3jx7a_

PDB Entry: 3jx7 (more details), 1.6 Å

PDB Description: bacillus cereus alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog
PDB Compounds: (A:) Alkylpurine DNA Glycosylase AlkD

SCOPe Domain Sequences for d3jx7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jx7a_ a.118.1.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]}
pmhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdqk
dfqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivptf
lgdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsskef
fiqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqnyginnek

SCOPe Domain Coordinates for d3jx7a_:

Click to download the PDB-style file with coordinates for d3jx7a_.
(The format of our PDB-style files is described here.)

Timeline for d3jx7a_: