Lineage for d1adub1 (1adu B:180-265)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4174Fold a.54: Domain of early E2A DNA-binding protein, ADDBP [47723] (1 superfamily)
  4. 4175Superfamily a.54.1: Domain of early E2A DNA-binding protein, ADDBP [47724] (1 family) (S)
  5. 4176Family a.54.1.1: Domain of early E2A DNA-binding protein, ADDBP [47725] (1 protein)
  6. 4177Protein Domain of early E2A DNA-binding protein, ADDBP [47726] (1 species)
  7. 4178Species Human adenovirus type 5 [TaxId:28285] [47727] (4 PDB entries)
  8. 4181Domain d1adub1: 1adu B:180-265 [17889]
    Other proteins in same PDB: d1adua2, d1adua3, d1adub2, d1adub3

Details for d1adub1

PDB Entry: 1adu (more details), 3 Å

PDB Description: early e2a dna-binding protein

SCOP Domain Sequences for d1adub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adub1 a.54.1.1 (B:180-265) Domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5}
awekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnkt
fvtmmgrflqaylqsfaevtykhhep

SCOP Domain Coordinates for d1adub1:

Click to download the PDB-style file with coordinates for d1adub1.
(The format of our PDB-style files is described here.)

Timeline for d1adub1: