Lineage for d1adub1 (1adu B:180-265)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715126Fold a.54: Domain of early E2A DNA-binding protein, ADDBP [47723] (1 superfamily)
    4 helices; bundle, partly opened
  4. 2715127Superfamily a.54.1: Domain of early E2A DNA-binding protein, ADDBP [47724] (2 families) (S)
    this domain is the first in the fragment of known structure
    automatically mapped to Pfam PF02236
  5. 2715128Family a.54.1.1: Domain of early E2A DNA-binding protein, ADDBP [47725] (1 protein)
  6. 2715129Protein Domain of early E2A DNA-binding protein, ADDBP [47726] (1 species)
    Single-stranded DNA-binding protein
  7. 2715130Species Human adenovirus type 5 [TaxId:28285] [47727] (4 PDB entries)
  8. 2715133Domain d1adub1: 1adu B:180-265 [17889]
    Other proteins in same PDB: d1adua2, d1adua3, d1adub2, d1adub3
    complexed with zn

Details for d1adub1

PDB Entry: 1adu (more details), 3 Å

PDB Description: early e2a dna-binding protein
PDB Compounds: (B:) adenovirus single-stranded DNA-binding protein

SCOPe Domain Sequences for d1adub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adub1 a.54.1.1 (B:180-265) Domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
awekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnkt
fvtmmgrflqaylqsfaevtykhhep

SCOPe Domain Coordinates for d1adub1:

Click to download the PDB-style file with coordinates for d1adub1.
(The format of our PDB-style files is described here.)

Timeline for d1adub1: