SCOPe 2.08: Domain d1adub1: 1adu B:180-265

Lineage for d1adub1 (1adu B:180-265)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.54: Domain of early E2A DNA-binding protein, ADDBP [47723] (1 superfamily)
   4 helices; bundle, partly opened

4. Superfamily a.54.1: Domain of early E2A DNA-binding protein, ADDBP [47724] (2 families)
   this domain is the first in the fragment of known structure
   automatically mapped to Pfam PF02236

5. Family a.54.1.1: Domain of early E2A DNA-binding protein, ADDBP [47725] (1 protein)

6. Protein Domain of early E2A DNA-binding protein, ADDBP [47726] (1 species)
   Single-stranded DNA-binding protein

7. Species Human adenovirus type 5 [TaxId:28285] [47727] (4 PDB entries)

8. Domain d1adub1: 1adu B:180-265 [17889]
   Other proteins in same PDB: d1adua2, d1adua3, d1adub2, d1adub3
   complexed with zn

Details for d1adub1

PDB Entry: 1adu, 3 Å

PDB Description: early e2a dna-binding protein

PDB Compounds: (B:) adenovirus single-stranded DNA-binding protein

SCOPe Domain Sequences for d1adub1:

Sequence; same for both SEQRES and ATOM records:

>d1adub1 a.54.1.1 (B:180-265) Domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
awekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnkt
fvtmmgrflqaylqsfaevtykhhep

Timeline for d1adub1:

• d1adub1 first appeared (with stable ids) in SCOP 1.55
  
• d1adub1 appears in SCOPe 2.07