![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.54: Domain of early E2A DNA-binding protein, ADDBP [47723] (1 superfamily) 4 helices; bundle, partly opened |
![]() | Superfamily a.54.1: Domain of early E2A DNA-binding protein, ADDBP [47724] (1 family) ![]() this domain is the first in the fragment of known structure |
![]() | Family a.54.1.1: Domain of early E2A DNA-binding protein, ADDBP [47725] (1 protein) |
![]() | Protein Domain of early E2A DNA-binding protein, ADDBP [47726] (1 species) Single-stranded DNA-binding protein |
![]() | Species Human adenovirus type 5 [TaxId:28285] [47727] (4 PDB entries) |
![]() | Domain d1adua1: 1adu A:180-265 [17888] Other proteins in same PDB: d1adua2, d1adua3, d1adub2, d1adub3 |
PDB Entry: 1adu (more details), 3 Å
SCOP Domain Sequences for d1adua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adua1 a.54.1.1 (A:180-265) Domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]} awekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnkt fvtmmgrflqaylqsfaevtykhhep
Timeline for d1adua1: