SCOPe 2.05: Domain d3jwmb_: 3jwm B:

Lineage for d3jwmb_ (3jwm B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d3jwmb_: 3jwm B: [178876]
   automated match to d1draa_
   complexed with 5wb, ndp

Details for d3jwmb_

PDB Entry: 3jwm, 2.57 Å

PDB Description: crystal structure of bacillus anthracis dihydrofolate reductase complexed with nadph and (s)-2,4-diamino-5-(3-methoxy-3-(3,4,5- trimethoxyphenyl)prop-1-ynyl)-6-methylpyrimidine (ucp114a)

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d3jwmb_:

Sequence; same for both SEQRES and ATOM records:

>d3jwmb_ c.71.1.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
hhhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpg
rrniivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitki
hhafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d3jwmb_:

• d3jwmb_ first appeared in SCOPe 2.01
  
• d3jwmb_ appears in SCOPe 2.04
  
• d3jwmb_ is called d3jwmb1 in SCOPe 2.06
  
• d3jwmb_ appears in the current release, SCOPe 2.08, called d3jwmb1