SCOPe 2.08: Domain d3jwfa1: 3jwf A:1-162

Lineage for d3jwfa1 (3jwf A:1-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d3jwfa1: 3jwf A:1-162 [178871]
   Other proteins in same PDB: d3jwfa2, d3jwfb2
   automated match to d1draa_
   complexed with 5wa, ndp

Details for d3jwfa1

PDB Entry: 3jwf, 2.57 Å

PDB Description: crystal structure of bacillus anthracis (y102f) dihydrofolate reductase complexed with nadph and (r)-2,4-diamino-5-(3-hydroxy-3-(3, 4,5-trimethoxyphenyl)prop-1-ynyl)-6-methylpyrimidine (ucp113a)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3jwfa1:

Sequence; same for both SEQRES and ATOM records:

>d3jwfa1 c.71.1.0 (A:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqifdlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d3jwfa1:

• d3jwfa1 first appeared in SCOPe 2.01, called d3jwfa_
  
• d3jwfa1 appears in SCOPe 2.07