SCOPe 2.06: Domain d3jwcb1: 3jwc B:1-162

Lineage for d3jwcb1 (3jwc B:1-162)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d3jwcb1: 3jwc B:1-162 [178870]
   Other proteins in same PDB: d3jwca2, d3jwcb2
   automated match to d1draa_
   complexed with ekb, ndp

Details for d3jwcb1

PDB Entry: 3jwc, 2.57 Å

PDB Description: crystal structure of bacillus anthracis (y102f) dihydrofolate reductase complexed with nadph and 2,4-diamino-5-(3-(3,4,5- trimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120a)

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d3jwcb1:

Sequence; same for both SEQRES and ATOM records:

>d3jwcb1 c.71.1.0 (B:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqifdlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d3jwcb1:

• d3jwcb1 first appeared in SCOPe 2.01, called d3jwcb_
  
• d3jwcb1 was called d3jwcb_ in SCOPe 2.05
  
• d3jwcb1 appears in SCOPe 2.07
  
• d3jwcb1 appears in the current release, SCOPe 2.08