Lineage for d3jwba_ (3jwb A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2471297Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2471448Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 2471449Species Citrobacter freundii [TaxId:546] [142663] (9 PDB entries)
    Uniprot Q84AR1 2-398
  8. 2471453Domain d3jwba_: 3jwb A: [178868]
    automated match to d1y4ia1
    complexed with nle, peg

Details for d3jwba_

PDB Entry: 3jwb (more details), 1.63 Å

PDB Description: Crystal structure of L-methionine gamma-lyase from Citrobacter freundii with norleucine
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d3jwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwba_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]}
sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls
hsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape
erlkagitdglirlsvgledpediindlehairkat

SCOPe Domain Coordinates for d3jwba_:

Click to download the PDB-style file with coordinates for d3jwba_.
(The format of our PDB-style files is described here.)

Timeline for d3jwba_: