SCOPe 2.07: Domain d3jwaa_: 3jwa A:

Lineage for d3jwaa_ (3jwa A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)

6. Protein Methionine gamma-lyase, MGL [64126] (4 species)

7. Species Citrobacter freundii [TaxId:546] [142663] (9 PDB entries)
   Uniprot Q84AR1 2-398

8. Domain d3jwaa_: 3jwa A: [178867]
   automated match to d1y4ia1
   complexed with mpj, peg

Details for d3jwaa_

PDB Entry: 3jwa, 1.45 Å

PDB Description: Crystal structure of L-methionine gamma-lyase from Citrobacter freundii with methionine phosphinate

PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d3jwaa_:

Sequence; same for both SEQRES and ATOM records:

>d3jwaa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]}
sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls
hsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape
erlkagitdglirlsvgledpediindlehairkat

Timeline for d3jwaa_:

• d3jwaa_ first appeared in SCOPe 2.01
  
• d3jwaa_ appears in SCOPe 2.06