Lineage for d3jwaa_ (3jwa A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895835Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 2895836Species Citrobacter freundii [TaxId:546] [142663] (9 PDB entries)
    Uniprot Q84AR1 2-398
  8. 2895838Domain d3jwaa_: 3jwa A: [178867]
    automated match to d1y4ia1
    complexed with mpj, peg

Details for d3jwaa_

PDB Entry: 3jwa (more details), 1.45 Å

PDB Description: crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d3jwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwaa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]}
sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls
hsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape
erlkagitdglirlsvgledpediindlehairkat

SCOPe Domain Coordinates for d3jwaa_:

Click to download the PDB-style file with coordinates for d3jwaa_.
(The format of our PDB-style files is described here.)

Timeline for d3jwaa_: