![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
![]() | Protein Methionine gamma-lyase, MGL [64126] (4 species) |
![]() | Species Citrobacter freundii [TaxId:546] [142663] (9 PDB entries) Uniprot Q84AR1 2-398 |
![]() | Domain d3jw9a_: 3jw9 A: [178866] automated match to d1y4ia1 complexed with ecx, peg |
PDB Entry: 3jw9 (more details), 1.8 Å
SCOPe Domain Sequences for d3jw9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jw9a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls hsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape erlkagitdglirlsvgledpediindlehairkat
Timeline for d3jw9a_: