Lineage for d3jw4b_ (3jw4 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (73 species)
    not a true protein
  7. 2307243Species Clostridium acetobutylicum [TaxId:1488] [189157] (1 PDB entry)
  8. 2307245Domain d3jw4b_: 3jw4 B: [178862]
    automated match to d2fbha1
    complexed with gol, imd, k

Details for d3jw4b_

PDB Entry: 3jw4 (more details), 2.1 Å

PDB Description: The structure of a putative MarR family transcriptional regulator from Clostridium acetobutylicum
PDB Compounds: (B:) Transcriptional regulator, MarR/EmrR family

SCOPe Domain Sequences for d3jw4b_:

Sequence, based on SEQRES records: (download)

>d3jw4b_ a.4.5.0 (B:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
lmdtpysylirsigmklktsadarlaelglnsqqgrmigyiyenqesgiiqkdlaqffgr
rgasitsmlqglekkgyierripennarqkniyvlpkgaalveefnnifleveesitkgl
tkdeqkqlmsilikvnrsm

Sequence, based on observed residues (ATOM records): (download)

>d3jw4b_ a.4.5.0 (B:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
lmdtpysylirsigmklktsadarlaelglnsqqgrmigyiyenqesgiiqkdlaqasit
smlqglekkgyierripqkniyvlpkgaalveefnnifleveesitkgltkdeqkqlmsi
likvnrsm

SCOPe Domain Coordinates for d3jw4b_:

Click to download the PDB-style file with coordinates for d3jw4b_.
(The format of our PDB-style files is described here.)

Timeline for d3jw4b_: