Lineage for d3jw4a_ (3jw4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (73 species)
    not a true protein
  7. 2307243Species Clostridium acetobutylicum [TaxId:1488] [189157] (1 PDB entry)
  8. 2307244Domain d3jw4a_: 3jw4 A: [178861]
    automated match to d2fbha1
    complexed with gol, imd, k

Details for d3jw4a_

PDB Entry: 3jw4 (more details), 2.1 Å

PDB Description: The structure of a putative MarR family transcriptional regulator from Clostridium acetobutylicum
PDB Compounds: (A:) Transcriptional regulator, MarR/EmrR family

SCOPe Domain Sequences for d3jw4a_:

Sequence, based on SEQRES records: (download)

>d3jw4a_ a.4.5.0 (A:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
dtpysylirsigmklktsadarlaelglnsqqgrmigyiyenqesgiiqkdlaqffgrrg
asitsmlqglekkgyierripennarqkniyvlpkgaalveefnnifleveesitkgltk
deqkqlmsilikvnrsm

Sequence, based on observed residues (ATOM records): (download)

>d3jw4a_ a.4.5.0 (A:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
dtpysylirsigmklktsadarlaelglnsqqgrmigyiyenqesgiiqkdlaqfsitsm
lqglekkgyierrkniyvlpkgaalveefnnifleveesitkgltkdeqkqlmsilikvn
rsm

SCOPe Domain Coordinates for d3jw4a_:

Click to download the PDB-style file with coordinates for d3jw4a_.
(The format of our PDB-style files is described here.)

Timeline for d3jw4a_: