Lineage for d3jw3a1 (3jw3 A:1-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904038Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)
  8. 2904115Domain d3jw3a1: 3jw3 A:1-162 [178859]
    Other proteins in same PDB: d3jw3a2, d3jw3b2
    automated match to d1draa_
    complexed with ndp, top

Details for d3jw3a1

PDB Entry: 3jw3 (more details), 2.57 Å

PDB Description: crystal structure of bacillus anthracis (f96i) dihydrofolate reductase complexed with nadph and trimethoprim
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3jw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jw3a1 c.71.1.0 (A:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeifiiggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d3jw3a1:

Click to download the PDB-style file with coordinates for d3jw3a1.
(The format of our PDB-style files is described here.)

Timeline for d3jw3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jw3a2