Lineage for d3jw1b_ (3jw1 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928489Protein automated matches [190061] (7 species)
    not a true protein
  7. 2928492Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2928568Domain d3jw1b_: 3jw1 B: [178856]
    automated match to d1a2wa_
    complexed with u5p

Details for d3jw1b_

PDB Entry: 3jw1 (more details), 1.6 Å

PDB Description: crystal structure of bovine pancreatic ribonuclease complexed with uridine-5'-monophosphate at 1.60 a resolution
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3jw1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jw1b_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d3jw1b_:

Click to download the PDB-style file with coordinates for d3jw1b_.
(The format of our PDB-style files is described here.)

Timeline for d3jw1b_: