SCOPe 2.06: Domain d3jvwb_: 3jvw B:

Lineage for d3jvwb_ (3jvw B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [188980] (3 PDB entries)

8. Domain d3jvwb_: 3jvw B: [178851]
   automated match to d1fgcc_
   complexed with dmp; mutant

Details for d3jvwb_

PDB Entry: 3jvw, 1.8 Å

PDB Description: hiv-1 protease mutant g86a with symmetric inhibitor dmp323

PDB Compounds: (B:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3jvwb_:

Sequence; same for both SEQRES and ATOM records:

>d3jvwb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniiarnlltqigatlnf

Timeline for d3jvwb_:

• d3jvwb_ first appeared in SCOPe 2.01
  
• d3jvwb_ appears in SCOPe 2.05
  
• d3jvwb_ appears in SCOPe 2.07
  
• d3jvwb_ appears in the current release, SCOPe 2.08